Recombinant Staphylococcus aureus Serine-aspartate repeat-containing protein D (sdrD), partial

Catalog Number: CSB-EP818920SUL
Article Name: Recombinant Staphylococcus aureus Serine-aspartate repeat-containing protein D (sdrD), partial
Biozol Catalog Number: CSB-EP818920SUL
Supplier Catalog Number: CSB-EP818920SUL
Alternative Catalog Number: CSB-EP818920SUL-1, CSB-EP818920SUL-100, CSB-EP818920SUL-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: sdrD,MW0517
Molecular Weight: 65.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8NXX6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 36-568aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LVGTTLIFGLGNQEAKAAESTNKELNEATTSASDNQSSDKVDMQQLNQEDNTKNDNQKEMVSSQGNETTSNGNKSIEKESVQSTTGNKVEVSTAKSDEQASPKSTNEDLNTKQTISNQEALQPDLQENKSVVNAQPTNEENKKVDAKTESTTLNVKSDAIKSNAETLVDNNSNSNNENNADIILPKSTAPKRLNTRMRIAAVQPSSTEAKNVNDLITSNTTLTVVDADKNNKIVPAQDYLELKSQIKVDDKVKSG
Application Notes: Research Areas: Others