Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)

Catalog Number: CSB-EP843142HU
Article Name: Recombinant Human Ly6/PLAUR domain-containing protein 1 (LYPD1)
Biozol Catalog Number: CSB-EP843142HU
Supplier Catalog Number: CSB-EP843142HU
Alternative Catalog Number: CSB-EP843142HU-1, CSB-EP843142HU-100, CSB-EP843142HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Putative HeLa tumor suppressor
Molecular Weight: 17.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8N2G4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.227.
Source: E.coli
Expression System: 21-117aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSS
Application Notes: Research Areas: Cancer