Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial

Catalog Number: CSB-EP851556HU2C7
Article Name: Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18), partial
Biozol Catalog Number: CSB-EP851556HU2C7
Supplier Catalog Number: CSB-EP851556HU2c7
Alternative Catalog Number: CSB-EP851556HU2C7-1, CSB-EP851556HU2C7-100, CSB-EP851556HU2C7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 73.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8TE60
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.241.
Source: E.coli
Expression System: 48-650aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SDSSSGASGLNDDYVFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSSPAGHHPHVLYKRTAEEKIQRYRGYPGSGRNYPGYSPSHIPHASQSRETEYHHRRLQKQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLNVETLVVAD
Application Notes: Research Areas: Cell Biology