Recombinant Human RB1-inducible coiled-coil protein 1 (RB1CC1), partial

Catalog Number: CSB-EP855061HU1C7
Article Name: Recombinant Human RB1-inducible coiled-coil protein 1 (RB1CC1), partial
Biozol Catalog Number: CSB-EP855061HU1C7
Supplier Catalog Number: CSB-EP855061HU1c7
Alternative Catalog Number: CSB-EP855061HU1C7-1, CSB-EP855061HU1C7-100, CSB-EP855061HU1C7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FAK family kinase-interacting protein of 200 kDa
Molecular Weight: 47.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q8TDY2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.213.
Source: E.coli
Expression System: 1241-1594aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEK
Application Notes: Research Areas: Others