Recombinant Human Prohibitin-2 (PHB2)
Catalog Number:
CSB-EP859937HUD7
- Images (0)
| Article Name: | Recombinant Human Prohibitin-2 (PHB2) |
| Biozol Catalog Number: | CSB-EP859937HUD7 |
| Supplier Catalog Number: | CSB-EP859937HUd7 |
| Alternative Catalog Number: | CSB-EP859937HUD7-1,CSB-EP859937HUD7-100,CSB-EP859937HUD7-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | B-cell receptor-associated protein BAP37,D-prohibitin,Repressor of estrogen receptor activity |
| Molecular Weight: | 40.8 kDa |
| Tag: | C-terminal 10xHis-tagged |
| UniProt: | Q99623 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | E.coli |
| Expression System: | 1-299aa |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIR |
Product Guarantee and Expert Support
