Recombinant Human Methionine synthase (MTR), partial

Catalog Number: CSB-EP859939HU
Article Name: Recombinant Human Methionine synthase (MTR), partial
Biozol Catalog Number: CSB-EP859939HU
Supplier Catalog Number: CSB-EP859939HU
Alternative Catalog Number: CSB-EP859939HU-1, CSB-EP859939HU-100, CSB-EP859939HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: 5-methyltetrahydrofolate--homocysteine methyltransferase Vitamin-B12 dependent methionine synthase Short name: MS
Molecular Weight: 55 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q99707
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 923-1265aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGY