Recombinant Human Aconitate hydratase, mitochondrial (ACO2) (K68R)

Catalog Number: CSB-EP859943HU(M)
Article Name: Recombinant Human Aconitate hydratase, mitochondrial (ACO2) (K68R)
Biozol Catalog Number: CSB-EP859943HU(M)
Supplier Catalog Number: CSB-EP859943HU(M)
Alternative Catalog Number: CSB-EP859943HU(M)-1, CSB-EP859943HU(M)-100, CSB-EP859943HU(M)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Aconitase,Citrate hydro-lyase
Molecular Weight: 92.4 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q99798
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-780aa(K68R)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSERIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGIL