Recombinant Human Desmoglein-1(DSG1),partial

Catalog Number: CSB-EP861938HU
Article Name: Recombinant Human Desmoglein-1(DSG1),partial
Biozol Catalog Number: CSB-EP861938HU
Supplier Catalog Number: CSB-EP861938HU
Alternative Catalog Number: CSB-EP861938HU-1, CSB-EP861938HU-100, CSB-EP861938HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Cadherin family member 4,Desmosomal glycoprotein 1,Pemphigus foliaceus antigen
Molecular Weight: 58.1 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q02413
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.245.
Source: E.coli
Expression System: 50-548aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EWIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFSANWM
Application Notes: Research Areas: Cancer