Recombinant Human Plexin-A4 (PLXNA4), partial

Catalog Number: CSB-EP862071HU
Article Name: Recombinant Human Plexin-A4 (PLXNA4), partial
Biozol Catalog Number: CSB-EP862071HU
Supplier Catalog Number: CSB-EP862071HU
Alternative Catalog Number: CSB-EP862071HU-1, CSB-EP862071HU-100, CSB-EP862071HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: FAYV2820, KIAA1550, PLEXA4, Plexin-A4, PlexinA4, PLXA4_HUMAN, plxna4, PLXNA4A, PLXNA4B, PRO34003, UNQ2820/PRO34003
Molecular Weight: 60 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9HCM2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 25-521aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERTGHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLIDYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLDDKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDFDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSK
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.