Recombinant Human Endogenous retrovirus group K member 5 Gag polyprotein (ERVK-5)

Catalog Number: CSB-EP862077HU
Article Name: Recombinant Human Endogenous retrovirus group K member 5 Gag polyprotein (ERVK-5)
Biozol Catalog Number: CSB-EP862077HU
Supplier Catalog Number: CSB-EP862077HU
Alternative Catalog Number: CSB-EP862077HU-1, CSB-EP862077HU-100, CSB-EP862077HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: HERV-K(II) Gag protein (HERV-K_3q12.3 provirus ancestral Gag polyprotein) (Gag polyprotein)
Molecular Weight: 80.9 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9HDB9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-667aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GQTKSKTKSKYASYLSFIKILLKRGGVRVSTKNLIKLFQIIEQFCPWFPEQGTLDLKDWKRIGEELKQAGRKGNIIPLTVWNDWAIIKAALEPFQTKEDSVSVSDAPGSCVIDCNEKTGRKSQKETESLHCEYVTEPVMAQSTQNVDYNQLQGVIYPETLKLEGKGPELVGPSESKPRGPSPLPAGQVPVTLQPQTQVKENKTQPPVAYQYWPPAELQYLPPPESQYGYPGMPPALQGRAPYPQPPTVRLNPTAS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.