Recombinant Mouse Nucleoplasmin-3 (Npm3)

Catalog Number: CSB-EP871862MO
Article Name: Recombinant Mouse Nucleoplasmin-3 (Npm3)
Biozol Catalog Number: CSB-EP871862MO
Supplier Catalog Number: CSB-EP871862MO
Alternative Catalog Number: CSB-EP871862MO-1, CSB-EP871862MO-100, CSB-EP871862MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 25.8 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9CPP0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.112.
Source: E.coli
Expression System: 2-175aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AAGAAAALAFLNQESRARAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDTEHVLALNMLCLTEGATDECNVVEVVARDHDNQEIAVPVANLRLSCQPMLSVDDFQLQPPVTFRLKSGSGPVRITGRHQIVCINNDLSEEESDDESEEDEIKLCGILPAKKHRGRP
Application Notes: Research Areas: Epigenetics and Nuclear Signaling