Recombinant Human Beta-catenin-interacting protein 1 (CTNNBIP1)

Catalog Number: CSB-EP873645HU
Article Name: Recombinant Human Beta-catenin-interacting protein 1 (CTNNBIP1)
Biozol Catalog Number: CSB-EP873645HU
Supplier Catalog Number: CSB-EP873645HU
Alternative Catalog Number: CSB-EP873645HU-1, CSB-EP873645HU-100, CSB-EP873645HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Inhibitor of beta-catenin and Tcf-4
Molecular Weight: 36.2 kDa
Tag: N-terminal GST-tagged
UniProt: Q9NSA3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-81aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ