Recombinant Human BMP-2-inducible protein kinase (BMP2K), partial

Catalog Number: CSB-EP873649HU
Article Name: Recombinant Human BMP-2-inducible protein kinase (BMP2K), partial
Biozol Catalog Number: CSB-EP873649HU
Supplier Catalog Number: CSB-EP873649HU
Alternative Catalog Number: CSB-EP873649HU-1, CSB-EP873649HU-100, CSB-EP873649HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (BIKe)
Molecular Weight: 41.9 kDa
Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
UniProt: Q9NSY1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 39-344aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCL