Recombinant Human Interleukin-36 gamma (IL36G)

Catalog Number: CSB-EP873706HU
Article Name: Recombinant Human Interleukin-36 gamma (IL36G)
Biozol Catalog Number: CSB-EP873706HU
Supplier Catalog Number: CSB-EP873706HU
Alternative Catalog Number: CSB-EP873706HU-1, CSB-EP873706HU-100, CSB-EP873706HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: IL-1-related protein 2
Molecular Weight: 45.7 kDa
Tag: N-terminal GST-tagged
UniProt: Q9NZH8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1-169aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.