Recombinant Human Meiotic nuclear division protein 1 homolog (MND1)

Catalog Number: CSB-EP880120HU
Article Name: Recombinant Human Meiotic nuclear division protein 1 homolog (MND1)
Biozol Catalog Number: CSB-EP880120HU
Supplier Catalog Number: CSB-EP880120HU
Alternative Catalog Number: CSB-EP880120HU-1, CSB-EP880120HU-100, CSB-EP880120HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: MND1,GAJ
Molecular Weight: 30.5 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9BWT6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 2-205aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID
Application Notes: Research Areas: Cancer. Endotoxin: Not test