Recombinant Human Probable ATP-dependent RNA helicase DDX4 (DDX4)

Catalog Number: CSB-EP882074HU
Article Name: Recombinant Human Probable ATP-dependent RNA helicase DDX4 (DDX4)
Biozol Catalog Number: CSB-EP882074HU
Supplier Catalog Number: CSB-EP882074HU
Alternative Catalog Number: CSB-EP882074HU-1, CSB-EP882074HU-100, CSB-EP882074HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: DEAD box protein 4,Vasa homolog
Molecular Weight: 86.2 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9NQI0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.79.
Source: E.coli
Expression System: 1-724aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSEASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGDTSQSRSGSGSERGGYKGLNEEVITGSGKNSWKSEAEGGESSDTQGPKVTYIPPPPPEDE
Application Notes: Research Areas: Epigenetics and Nuclear Signaling