Recombinant Human Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), partial

Catalog Number: CSB-EP887006HU
Article Name: Recombinant Human Tumor necrosis factor receptor superfamily member 10D (TNFRSF10D), partial
Biozol Catalog Number: CSB-EP887006HU
Supplier Catalog Number: CSB-EP887006HU
Alternative Catalog Number: CSB-EP887006HU-1, CSB-EP887006HU-100, CSB-EP887006HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Decoy receptor 2,TNF-related apoptosis-inducing ligand receptor 4,TRAIL receptor with a truncated death domain
Molecular Weight: 29.8 kDa
Tag: N-terminal 6xHis-SUMO-tagged
UniProt: Q9UBN6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.177.
Source: E.coli
Expression System: 56-211aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Application Notes: Research Areas: Cancer