Recombinant Human Unconventional myosin-XVI (MYO16), partial

Catalog Number: CSB-EP897596HU5
Article Name: Recombinant Human Unconventional myosin-XVI (MYO16), partial
Biozol Catalog Number: CSB-EP897596HU5
Supplier Catalog Number: CSB-EP897596HU5
Alternative Catalog Number: CSB-EP897596HU5-1, CSB-EP897596HU5-100, CSB-EP897596HU5-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3,Unconventional myosin-16
Molecular Weight: 22.6 kDa
Tag: C-terminal 6xHis-tagged
UniProt: Q9Y6X6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: E.coli
Expression System: 1303-1453aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DPNTRLSASYEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLH
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.