Recombinant Human Dipeptidase 1 (DPEP1)

Catalog Number: CSB-MP007123HU
Article Name: Recombinant Human Dipeptidase 1 (DPEP1)
Biozol Catalog Number: CSB-MP007123HU
Supplier Catalog Number: CSB-MP007123HU
Alternative Catalog Number: CSB-MP007123HU-1, CSB-MP007123HU-100, CSB-MP007123HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-lactamase,Dehydropeptidase-I,Microsomal dipeptidase,Renal dipeptidase,hRDP
Molecular Weight: 42.8 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P16444
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 17-385aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNY
The purity of DPEP1 was greater than 95% as determined by SEC-HPLC
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.