Recombinant Human Kallikrein-2 (KLK2), Biotinylated

Catalog Number: CSB-MP012453HUK7-B
Article Name: Recombinant Human Kallikrein-2 (KLK2), Biotinylated
Biozol Catalog Number: CSB-MP012453HUK7-B
Supplier Catalog Number: CSB-MP012453HUk7-B
Alternative Catalog Number: CSB-MP012453HUK7-B-1, CSB-MP012453HUK7-B-100, CSB-MP012453HUK7-B-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Glandular kallikrein-1,Tissue kallikrein-2
Molecular Weight: 29.9 kDa
Tag: C-terminal 10xHis-G4S-Avi-tagged
UniProt: P20151
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 25-261aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Application Notes: Research Areas: Signal Transduction. Endotoxin: Not test