Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1 (Klrg1), partial, Biotinylated

Catalog Number: CSB-MP012472MO-B
Article Name: Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1 (Klrg1), partial, Biotinylated
Biozol Catalog Number: CSB-MP012472MO-B
Supplier Catalog Number: CSB-MP012472MO-B
Alternative Catalog Number: CSB-MP012472MO-B-1, CSB-MP012472MO-B-100, CSB-MP012472MO-B-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Mast cell function-associated antigen 2F1
Molecular Weight: 45.7 kDa
Tag: C-terminal hFc1-Avi-tagged
UniProt: O88713
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 57-188aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.