Recombinant Human Keratin, type I cytoskeletal 18 (KRT18)

Catalog Number: CSB-MP012519HU
Article Name: Recombinant Human Keratin, type I cytoskeletal 18 (KRT18)
Biozol Catalog Number: CSB-MP012519HU
Supplier Catalog Number: CSB-MP012519HU
Alternative Catalog Number: CSB-MP012519HU-1, CSB-MP012519HU-100, CSB-MP012519HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Cell proliferation-inducing gene 46 protein (Cytokeratin-18) (CK-18) (Keratin-18) (K18) (CYK18)
Molecular Weight: 50.8 kDa
Tag: N-terminal 10xHis-tagged
UniProt: P05783
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 2-430aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQY
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.