Recombinant Pig Lepti(LEP)

Catalog Number: CSB-MP012870PI
Article Name: Recombinant Pig Lepti(LEP)
Biozol Catalog Number: CSB-MP012870PI
Supplier Catalog Number: CSB-MP012870PI
Alternative Catalog Number: CSB-MP012870PI-1, CSB-MP012870PI-100, CSB-MP012870PI-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Obesity factor
Molecular Weight: 43.7 kDa
Tag: C-terminal mFc2a-tagged
UniProt: Q29406
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.22.
Source: Mammalian cell
Expression System: 22-167aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VPIWRVQDDTKTLIKTIVTRISDISHMQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARALETLESLGGVLEASLYSTEVVALSRLQGALQDMLRQLDLSPGC
Application Notes: Research Areas: Neuroscience