Recombinant Human LIM domain kinase 2 (LIMK2), partial

Catalog Number: CSB-MP012953HU(F3)
Article Name: Recombinant Human LIM domain kinase 2 (LIMK2), partial
Biozol Catalog Number: CSB-MP012953HU(F3)
Supplier Catalog Number: CSB-MP012953HU(F3)
Alternative Catalog Number: CSB-MP012953HU(F3)-1, CSB-MP012953HU(F3)-100, CSB-MP012953HU(F3)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 103.7 kDa
Tag: N-terminal HSA-tagged and C-terminal 10xHis-tagged
UniProt: P53671
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.168.
Source: Mammalian cell
Expression System: 347-659aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYDP
Application Notes: Research Areas: Cancer