Recombinant Mouse Natural cytotoxicity triggering receptor 1 (Ncr1), partial

Catalog Number: CSB-MP015549MO
Article Name: Recombinant Mouse Natural cytotoxicity triggering receptor 1 (Ncr1), partial
Biozol Catalog Number: CSB-MP015549MO
Supplier Catalog Number: CSB-MP015549MO
Alternative Catalog Number: CSB-MP015549MO-1, CSB-MP015549MO-100, CSB-MP015549MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Activating receptor 1,Lymphocyte antigen 94,Natural killer cell p46-related protein
Molecular Weight: 28.5 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q8C567
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 17-255aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QRINTEKETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIYTCFYQSGELWSKSSNPLKLVVTGLYDTPNLWVYPRPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVTRAHRGTYRCFGSYNDYAWSFPSEPVTLLITGGVENSSLAPTDPTSSLDYWEFDLSTNESGLQKDSAFWDHTTQN
Application Notes: Research Areas: Cancer