Recombinant Mouse Prolactin (Prl)

Catalog Number: CSB-MP018724MO
Article Name: Recombinant Mouse Prolactin (Prl)
Biozol Catalog Number: CSB-MP018724MO
Supplier Catalog Number: CSB-MP018724MO
Alternative Catalog Number: CSB-MP018724MO-1, CSB-MP018724MO-100, CSB-MP018724MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 23.8 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P06879
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.54.
Source: Mammalian cell
Expression System: 30-226aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
Application Notes: Research Areas: Signal Transduction