Recombinant Mouse Serum amyloid A-2 protein(Saa2)

Catalog Number: CSB-MP020657MO
Article Name: Recombinant Mouse Serum amyloid A-2 protein(Saa2)
Biozol Catalog Number: CSB-MP020657MO
Supplier Catalog Number: CSB-MP020657MO
Alternative Catalog Number: CSB-MP020657MO-1, CSB-MP020657MO-100, CSB-MP020657MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Saa2
Molecular Weight: 13.7 kDa
Tag: N-terminal 6xHis-tagged
UniProt: P05367
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 20-122aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
Application Notes: Research Areas: Others