Recombinant Human Alpha-2-antiplasmin (SERPINF2)

Catalog Number: CSB-MP021085HU
Article Name: Recombinant Human Alpha-2-antiplasmin (SERPINF2)
Biozol Catalog Number: CSB-MP021085HU
Supplier Catalog Number: CSB-MP021085HU
Alternative Catalog Number: CSB-MP021085HU-1, CSB-MP021085HU-100, CSB-MP021085HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Alpha-2-plasmin inhibitor,Serpin F2
Molecular Weight: 53.1 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P08697
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 28-491aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEPLGRQLTSGPNQEQVSPLTLLKLGNQEPGGQTALKSPPGVCSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSHLALGAQNHTLQRLQQVLHAGSGPCLPHLLSRLCQDLGPGAFRLAARMYLQKGFPIKEDFLEQSEQLFGAKPVSLTGKQEDDLANINQWVKEATEGKIQEFLSGLPEDTVLLLLNAIHFQGFWRNKFDPSLTQRDSFHLDEQFTVPVEMMQARTYPLRWFLLEQ
Application Notes: Research Areas: Cardiovascular. Endotoxin: Not test