Recombinant Human Angiopoietin-1 receptor (TEK), partial

Catalog Number: CSB-MP023375HU
Article Name: Recombinant Human Angiopoietin-1 receptor (TEK), partial
Biozol Catalog Number: CSB-MP023375HU
Supplier Catalog Number: CSB-MP023375HU
Alternative Catalog Number: CSB-MP023375HU-1, CSB-MP023375HU-100, CSB-MP023375HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Endothelial tyrosine kinase,Tunica interna endothelial cell kinase,Tyrosine kinase with Ig and EGF homology domains-2,Tyrosine-protein kinase receptor TEK,Tyrosine-protein kinase receptor TIE-2,p140 TEK
Molecular Weight: 82.4 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q02763
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 23-748aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSY
Application Notes: Research Areas: Cancer