Recombinant Human Serotransferrin (TF), Biotinylated

Catalog Number: CSB-MP023412HUK7-B
Article Name: Recombinant Human Serotransferrin (TF), Biotinylated
Biozol Catalog Number: CSB-MP023412HUK7-B
Supplier Catalog Number: CSB-MP023412HUk7-B
Alternative Catalog Number: CSB-MP023412HUK7-B-1, CSB-MP023412HUK7-B-100
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Beta-1 metal-binding globulin,Siderophilin
Molecular Weight: 78.7 kDa
Tag: C-terminal 10xHis-Avi-tagged
UniProt: P02787
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 20-698aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARS
Application Notes: Research Areas: Cancer