Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2), partial (Active)
Catalog Number:
CSB-MP023448HU-WD
- Images (0)
| Article Name: | Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2), partial (Active) |
| Biozol Catalog Number: | CSB-MP023448HU-WD |
| Supplier Catalog Number: | CSB-MP023448HU-WD |
| Alternative Catalog Number: | CSB-MP023448HU-WD-1, CSB-MP023448HU-WD-50, CSB-MP023448HU-WD-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Transforming growth factor beta-2, TGFB2, Polyergin, G-TSF, Glioblastoma-derived T-cell suppressor factor, Cetermin, BSC-1 cell growth inhibitor, TGF-beta-2 |
| Molecular Weight: | 12.7 kDa |
| Tag: | Tag free |
| UniProt: | P61812 |
| Buffer: | Lyophilized from a 0.2 µm filtered solution containing 0.085% TFA,5%mannitol and 30% ACN, pH 2.5 |
| Source: | Mammalian cell |
| Expression System: | 303-414aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
Product Guarantee and Expert Support
