Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial

Catalog Number: CSB-MP023981MOD9
Article Name: Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial
Biozol Catalog Number: CSB-MP023981MOD9
Supplier Catalog Number: CSB-MP023981MOd9
Alternative Catalog Number: CSB-MP023981MOD9-1, CSB-MP023981MOD9-100, CSB-MP023981MOD9-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: OX40 antigen,OX40L receptor
Molecular Weight: 50.2 kDa
Tag: C-terminal hFc1-tagged
UniProt: P47741
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.31.
Source: Mammalian cell
Expression System: 20-211aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Application Notes: Research Areas: Others