Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)
Catalog Number:
CSB-MP023989HU
- Images (0)
| Article Name: | Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active) |
| Biozol Catalog Number: | CSB-MP023989HU |
| Supplier Catalog Number: | CSB-MP023989HU |
| Alternative Catalog Number: | CSB-MP023989HU-1,CSB-MP023989HU-100,CSB-MP023989HU-20 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Tumor necrosis factor ligand superfamily member 13, A proliferation-inducing ligand (APRIL), TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2), TNF-related death ligand 1 (TRDL-1), CD256, TNFSF13, APRIL, TALL2, ZTNF2, UNQ383/PRO715 |
| Molecular Weight: | 42.6 kDa |
| Tag: | N-terminal hFc-tagged |
| UniProt: | O75888 |
| Buffer: | Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4 |
| Source: | Mammalian cell |
| Expression System: | 105-250aa |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Lyophilized powder |
| Sequence: | AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL |
Product Guarantee and Expert Support
