Recombinant Human Cellular tumor antigen p53 (TP53)

Catalog Number: CSB-MP024077HU
Article Name: Recombinant Human Cellular tumor antigen p53 (TP53)
Biozol Catalog Number: CSB-MP024077HU
Supplier Catalog Number: CSB-MP024077HU
Alternative Catalog Number: CSB-MP024077HU-1, CSB-MP024077HU-100, CSB-MP024077HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Antigen NY-CO-13,Phosphoprotein p53,Tumor suppressor p53
Molecular Weight: 49.9 kDa
Tag: C-terminal 10xHis-tagged
UniProt: P04637
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 1-393aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTII
Application Notes: Research Areas: Apoptosis. Endotoxin: Not test