Recombinant Human Triggering receptor expressed on myeloid cells 1 (TREM-1), partial

Catalog Number: CSB-MP024404HU
Article Name: Recombinant Human Triggering receptor expressed on myeloid cells 1 (TREM-1), partial
Biozol Catalog Number: CSB-MP024404HU
Supplier Catalog Number: CSB-MP024404HU
Alternative Catalog Number: CSB-MP024404HU-1, CSB-MP024404HU-100, CSB-MP024404HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Triggering receptor expressed on monocytes 1
Molecular Weight: 21.6 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q9NP99
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 21-200aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR
Application Notes: Research Areas: Cancer. Endotoxin: Not test