Recombinant Human Vitronectin (VTN) (Active)
Catalog Number:
CSB-MP025944HU-WD2
- Images (0)
| Article Name: | Recombinant Human Vitronectin (VTN) (Active) |
| Biozol Catalog Number: | CSB-MP025944HU-WD2 |
| Supplier Catalog Number: | CSB-MP025944HU-WD2 |
| Alternative Catalog Number: | CSB-MP025944HU-WD2-1, CSB-MP025944HU-WD2-50, CSB-MP025944HU-WD2-10 |
| Manufacturer: | Cusabio |
| Category: | Proteine/Peptide |
| Alternative Names: | Vitronectin, VN, S-Protein, Serum-Spreading Factor, V75, VTN |
| Molecular Weight: | 52.3 kDa |
| Tag: | Tag free |
| UniProt: | P04004 |
| Buffer: | 0.2 µm-filtered solution containing PBS,5% mannitol and 0.01% Tween 80, pH 7.4 |
| Source: | Mammalian cell |
| Expression System: | 20-478aa |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Form: | Liquid |
| Sequence: | DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFF |
Product Guarantee and Expert Support
