Recombinant Human Zinc finger Y-chromosomal protein (ZFY), partial

Catalog Number: CSB-MP026468HU
Article Name: Recombinant Human Zinc finger Y-chromosomal protein (ZFY), partial
Biozol Catalog Number: CSB-MP026468HU
Supplier Catalog Number: CSB-MP026468HU
Alternative Catalog Number: CSB-MP026468HU-1, CSB-MP026468HU-100, CSB-MP026468HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: ZFY
Molecular Weight: 46.7 kDa
Tag: C-terminal 6xHis-tagged
UniProt: P08048
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 1-409aa
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDITVHNFVPDDPDSVVIQDVVEDVVIEEDVQCSDILEEADVSENVIIPEQVLDSDVTEEVSLPHCTVPDDVLASDITSTSMSMPEHVLTSESMHVCDIGHVEHMVHDSVVEAEIITDPLTSDIVSEEVLVADCAPEAVIDASGISVDQQDNDKASCEDYLMISLDDAGKIEHDGSTGVTIDAESEMDPCKVDSTCPEVIKVYIFKAD
Application Notes: Research Areas: Others. Endotoxin: Not test