Recombinant Mouse IGF-like family receptor 1 (Igflr1), partial

Catalog Number: CSB-MP663649MO
Article Name: Recombinant Mouse IGF-like family receptor 1 (Igflr1), partial
Biozol Catalog Number: CSB-MP663649MO
Supplier Catalog Number: CSB-MP663649MO
Alternative Catalog Number: CSB-MP663649MO-1, CSB-MP663649MO-100, CSB-MP663649MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: (Transmembrane protein 149)
Molecular Weight: 44.2 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q3U4N7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 21-163aa
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPDHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTELCSQCSSGAAAAPAHVESPGRTHKQCRKKPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSAS
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.