Recombinant Macaca fascicularis 5-nucleotidase, partial

Catalog Number: CSB-MP7218MOV
Article Name: Recombinant Macaca fascicularis 5-nucleotidase, partial
Biozol Catalog Number: CSB-MP7218MOV
Supplier Catalog Number: CSB-MP7218MOV
Alternative Catalog Number: CSB-MP7218MOV-1, CSB-MP7218MOV-100, CSB-MP7218MOV-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 59.8 kDa
Tag: C-terminal 10xHis-tagged
UniProt: G7P3J1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.32.
Source: Mammalian cell
Expression System: 27-554aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFETDKLIAQKVRGVDVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAY
Application Notes: Research Areas: Others