Recombinant Human Interleukin-9 receptor (IL9R), partial

Catalog Number: CSB-MP7225HU
Article Name: Recombinant Human Interleukin-9 receptor (IL9R), partial
Biozol Catalog Number: CSB-MP7225HU
Supplier Catalog Number: CSB-MP7225HU
Alternative Catalog Number: CSB-MP7225HU-1, CSB-MP7225HU-100, CSB-MP7225HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: IL-9 receptor, IL-9R,CD129
Molecular Weight: 54.8 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q01113
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 41-270aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP
Application Notes: Research Areas: Others. Endotoxin: Not test