Recombinant Macaca mulatta TNF receptor superfamily member 13C (TNFRSF13C), partial

Catalog Number: CSB-MP7362MOW
Article Name: Recombinant Macaca mulatta TNF receptor superfamily member 13C (TNFRSF13C), partial
Biozol Catalog Number: CSB-MP7362MOW
Supplier Catalog Number: CSB-MP7362MOW
Alternative Catalog Number: CSB-MP7362MOW-1, CSB-MP7362MOW-100, CSB-MP7362MOW-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 9.8 kDa
Tag: C-terminal 10xHis-tagged
UniProt: A0A5F7ZFG6
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 7-76aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAPASSPAPRTALQPQESVGAGAGEAALSLPG
Application Notes: Research Areas: Others