Recombinant Mouse Prosaposin (Psap)(N459Q)

Catalog Number: CSB-MP736809MO(M)
Article Name: Recombinant Mouse Prosaposin (Psap)(N459Q)
Biozol Catalog Number: CSB-MP736809MO(M)
Supplier Catalog Number: CSB-MP736809MO(M)
Alternative Catalog Number: CSB-MP736809MO(M)-1, CSB-MP736809MO(M)-100, CSB-MP736809MO(M)-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Sulfated glycoprotein 1
Molecular Weight: 61.2 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q61207
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 17-557aa(N459Q)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SPVQDPKTCSGGSAVLCRDVKTAVDCGAVKHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDMARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAG
Application Notes: Research Areas: Neuroscience