Recombinant Mouse Receptor tyrosine-protein kinase erbB-3 (Erbb3), partial

Catalog Number: CSB-MP736823MO
Article Name: Recombinant Mouse Receptor tyrosine-protein kinase erbB-3 (Erbb3), partial
Biozol Catalog Number: CSB-MP736823MO
Supplier Catalog Number: CSB-MP736823MO
Alternative Catalog Number: CSB-MP736823MO-1, CSB-MP736823MO-100, CSB-MP736823MO-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: Glial growth factor receptor,Proto-oncogene-like protein c-ErbB-3
Molecular Weight: 70.0 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q61526
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.62.
Source: Mammalian cell
Expression System: 20-641aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHMDTIDWRDIVRVPDAEIVVKNNGGNCPPCHEVCKGRCWGPGPEDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEP
Application Notes: Research Areas: Cancer