Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial

Catalog Number: CSB-MP737873HUD9
Article Name: Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial
Biozol Catalog Number: CSB-MP737873HUD9
Supplier Catalog Number: CSB-MP737873HUd9
Alternative Catalog Number: CSB-MP737873HUD9-1, CSB-MP737873HUD9-100, CSB-MP737873HUD9-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: B7 homolog 6
Molecular Weight: 55.6 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q68D85
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.5.
Source: Mammalian cell
Expression System: 25-262aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS
Application Notes: Research Areas: Immunology