Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial, Biotinylated

Catalog Number: CSB-MP737873HUJ8-B
Article Name: Recombinant Human Natural cytotoxicity triggering receptor 3 ligand 1 (NCR3LG1), partial, Biotinylated
Biozol Catalog Number: CSB-MP737873HUJ8-B
Supplier Catalog Number: CSB-MP737873HUj8-B
Alternative Catalog Number: CSB-MP737873HUJ8-B-1, CSB-MP737873HUJ8-B-100, CSB-MP737873HUJ8-B-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: B7 homolog 6
Molecular Weight: 55.8 kDa
Tag: C-terminal hFc-avi-tagged
UniProt: Q68D85
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.165.
Source: Mammalian cell
Expression System: 25-262aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS
Application Notes: Research Areas: Immunology