Recombinant Dog tissue kallikrein (KLK5), partial

Catalog Number: CSB-MP7444DOD7
Article Name: Recombinant Dog tissue kallikrein (KLK5), partial
Biozol Catalog Number: CSB-MP7444DOD7
Supplier Catalog Number: CSB-MP7444DOd7
Alternative Catalog Number: CSB-MP7444DOD7-1, CSB-MP7444DOD7-100, CSB-MP7444DOD7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Molecular Weight: 27.6 kDa
Tag: C-terminal 10xHis-tagged
UniProt: A0A8C0M0S1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 68-294aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVNGTDCEKNAQPWQGALLLGPNKLYCGAVLVNPQWLLTAAHCRKPFFRIRLGHHSLSPVYEAGQQLFKGIKSIPHPGYSHPGHSNDLMLIKLNRKIRETQRVKPINISSKCPSAGTSCMVSGWGTTNSPNVQFPKVLQCLNITVLSDDRCRKAYPRQIDSTMFCAGDEAGRDSCQGDSGGPVVCNGSLQGLVSWGDFPCAQPNRPGVYTNLCQFTKWIKDTIQSNS
Application Notes: Research Areas: Others