Recombinant Human Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2), partial

Catalog Number: CSB-MP850263HUD7
Article Name: Recombinant Human Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2), partial
Biozol Catalog Number: CSB-MP850263HUD7
Supplier Catalog Number: CSB-MP850263HUd7
Alternative Catalog Number: CSB-MP850263HUD7-1, CSB-MP850263HUD7-100, CSB-MP850263HUD7-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CD28 homolog,Immunoglobulin and proline-rich receptor 1
Molecular Weight: 15.4 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q96BF3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.43.
Source: Mammalian cell
Expression System: 23-150aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG
Application Notes: Research Areas: Immunology