Recombinant Human Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3), partial

Catalog Number: CSB-MP850818HU
Article Name: Recombinant Human Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3), partial
Biozol Catalog Number: CSB-MP850818HU
Supplier Catalog Number: CSB-MP850818HU
Alternative Catalog Number: CSB-MP850818HU-1, CSB-MP850818HU-100, CSB-MP850818HU-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: CD158 antigen-like family member Z,Killer cell inhibitory receptor 1
Molecular Weight: 33.8 kDa
Tag: C-terminal 10xHis-tagged
UniProt: Q8N743
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.9.
Source: Mammalian cell
Expression System: 26-322aa
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANF
Application Notes: Research Areas: Immunology