Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C)(V29L,H31S), partial

Catalog Number: CSB-MP853495HU2(M2)-C
Article Name: Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C)(V29L,H31S), partial
Biozol Catalog Number: CSB-MP853495HU2(M2)-C
Supplier Catalog Number: CSB-MP853495HU2(M2)-C
Alternative Catalog Number: CSB-MP853495HU2(M2)-C-1, CSB-MP853495HU2(M2)-C-100, CSB-MP853495HU2(M2)-C-20
Manufacturer: Cusabio
Category: Proteine/Peptide
Alternative Names: B-cell-activating factor receptor,BAFF receptor,BLyS receptor 3
Molecular Weight: 36.1 kDa
Tag: C-terminal hFc1-tagged
UniProt: Q96RJ3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mammalian cell
Expression System: 2-71aa(V29L,H31S)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: RRGPRSLRGRDAPAPTPCVPAECFDLLLRSCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Application Notes: Research Areas: Cancer. Endotoxin: Not test