Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial (Active)
Catalog Number:
CSB-MP866317HU
| Article Name: |
Recombinant Human Angiotensin-converting enzyme 2 (ACE2), partial (Active) |
| Biozol Catalog Number: |
CSB-MP866317HU |
| Supplier Catalog Number: |
CSB-MP866317HU |
| Alternative Catalog Number: |
CSB-MP866317HU-1, CSB-MP866317HU-100, CSB-MP866317HU-20 |
| Manufacturer: |
Cusabio |
| Category: |
Proteine/Peptide |
| Alternative Names: |
/ |
| Molecular Weight: |
112.5 kDa |
| Tag: |
C-terminal hFc1-tagged |
| UniProt: |
Q9BYF1 |
| Buffer: |
Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Source: |
Mammalian cell |
| Expression System: |
18-740aa |
| Purity: |
Greater than 90% as determined by SDS-PAGE. |
| Form: |
Lyophilized powder |
| Sequence: |
QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWG |
![]()
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
